Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOBOX Rabbit Polyclonal Antibody (FITC)

NOBOX Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OG2, OG-2, OG2X, POF5, TCAG_12042

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NOBOX

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FPVCGLYRIYGVCGSFSSFFIIRCSLCALETLKSPQHDPLEIPEQSLKLI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

IHC, WB

NCBI Accession Number

XP_001134424

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calnexin (Endoplasmic Reticulum Marker) (CANX/1543), 0.2mg/mL
BNUB1543-500 1x 500 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1543), 0.2mg/mL

Sign In for Pricing
View Details
6-Heptynoic Acid
TRC-H265710-5G 5 g

6-Heptynoic Acid

Sign In for Pricing
View Details
Mouse GDNF (Glial Cell Line Derived Neurotrophic Factor) CLIA Kit
E-CL-M0332-01 24 Tests

Mouse GDNF (Glial Cell Line Derived Neurotrophic Factor) CLIA Kit

Sign In for Pricing
View Details
Mouse GDNF (Glial Cell Line Derived Neurotrophic Factor) CLIA Kit
E-CL-M0332-02 48 Tests

Mouse GDNF (Glial Cell Line Derived Neurotrophic Factor) CLIA Kit

Sign In for Pricing
View Details
Mouse GDNF (Glial Cell Line Derived Neurotrophic Factor) CLIA Kit
E-CL-M0332-03 96 Tests

Mouse GDNF (Glial Cell Line Derived Neurotrophic Factor) CLIA Kit

Sign In for Pricing
View Details
RNF144 (RNF144A) Rabbit Polyclonal Antibody
TA380977 100 µL

RNF144 (RNF144A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details