Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB38 Rabbit Polyclonal Antibody (HRP)

ZBTB38 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CIBZ, ZNF921, PPP1R171

UniProt

Q8NAP3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB38

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

131kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

XP_001133510

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM35A (ESRP1) Rabbit Polyclonal Antibody
TA368637 100 µL

RBM35A (ESRP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
CF812566 100 µg

TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI1G6]

Sign In for Pricing
View Details
Human ZIK1 activation kit by CRISPRa
GA117117 1 Kit

Human ZIK1 activation kit by CRISPRa

Sign In for Pricing
View Details
2,3-Dehydro-3,4-dihydro Moxidectin
TRC-D293860-2.5MG 2.5 mg

2,3-Dehydro-3,4-dihydro Moxidectin

Sign In for Pricing
View Details
Human Aspartate beta hydroxylase (ASPH) activation kit by CRISPRa
GA100320 1 Kit

Human Aspartate beta hydroxylase (ASPH) activation kit by CRISPRa

Sign In for Pricing
View Details
IL12B (NM_002187) Human Over-expression Lysate
LY400792 100 µg

IL12B (NM_002187) Human Over-expression Lysate

Sign In for Pricing
View Details