Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVX2 Rabbit Polyclonal Antibody (FITC)

EVX2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EVX-2

UniProt

Q03828

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LOC344191

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MMERIRKEMILMERGLHSPTAGKRFSNLSNSAGNAVLEALENSQHPARLS

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001073927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

High Mobility Group Box1 Protein (HMGB1) BioAssayTM ELISA Kit (Human) discontinued
194485-01 48 Tests

High Mobility Group Box1 Protein (HMGB1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
High Mobility Group Box1 Protein (HMGB1) BioAssayTM ELISA Kit (Human) discontinued
194485-02 96 Tests

High Mobility Group Box1 Protein (HMGB1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Serpinb6b shRNA (UAS) - Lentiviral mouse Serpinb6b shRNA (UAS, RFP) (25)
GTR15231923 1 Vial

Lentiviral mouse Serpinb6b shRNA (UAS) - Lentiviral mouse Serpinb6b shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
PFN3 (NM_001029886) Human Tagged Lenti ORF Clone
RC224947L4 10 µg

PFN3 (NM_001029886) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HSP70-1B (HSPA1B) Human Gene Knockout Kit (CRISPR)
KN409403 1 Kit

HSP70-1B (HSPA1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MuRF2 siRNA (m)
sc-149718 10 µM

MuRF2 siRNA (m)

Sign In for Pricing
View Details