Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVX2 Rabbit Polyclonal Antibody (HRP)

EVX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EVX-2

UniProt

Q03828

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EVX2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGAGAGGGSDFGCSAAAPRSESGFLPYSAAVLSKTAVSPPDQRDEAPLTR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001073927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Tumor necrosis factor receptor type 1-associated DEATH domain protein (TRADD)
CSB-EP621879HUc7-01 20 µg

Recombinant Human Tumor necrosis factor receptor type 1-associated DEATH domain protein (TRADD)

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor type 1-associated DEATH domain protein (TRADD)
CSB-EP621879HUc7-02 100 µg

Recombinant Human Tumor necrosis factor receptor type 1-associated DEATH domain protein (TRADD)

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor type 1-associated DEATH domain protein (TRADD)
CSB-EP621879HUc7-03 1 mg

Recombinant Human Tumor necrosis factor receptor type 1-associated DEATH domain protein (TRADD)

Sign In for Pricing
View Details
PRSS56 Polyclonal Antibody, RBITC Conjugated
bs-24096R-RBITC 100 µL

PRSS56 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Magic™ Membrane Protein Human CERS4 (Ceramide synthase 4) Full Length
MPC4542K Each

Magic™ Membrane Protein Human CERS4 (Ceramide synthase 4) Full Length

Sign In for Pricing
View Details
Recombinant Mycobacterium vanbaalenii Acetylglutamate kinase (argB)
MBS1097900-01 0.02 mg (E-Coli)

Recombinant Mycobacterium vanbaalenii Acetylglutamate kinase (argB)

Sign In for Pricing
View Details