Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppargc1a Rabbit Polyclonal Antibody (HRP)

Ppargc1a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pgc, Pgc1, PGC-1, Pgco1, Gm11133, Ppargc1, Pgc-1alpha, A830037N07Rik, PPARGC-1-alpha

UniProt

O70343

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Ppargc1a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_032930

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCY2C (Guanylate Cyclase 2C (Heat Stable Enterotoxin Receptor), GUC2C, STAR)
246865 100 µg

GUCY2C (Guanylate Cyclase 2C (Heat Stable Enterotoxin Receptor), GUC2C, STAR)

Sign In for Pricing
View Details
RHOT1 Recombinant Protein (Mouse)
RP168044 100 µg

RHOT1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
hsa-miR-6780a-5p miRNA Antagomir
MNH03520 2x 5.0 nmol

hsa-miR-6780a-5p miRNA Antagomir

Sign In for Pricing
View Details
RPL23AP68 ORF Vector (Human) (pORF)
ORF030385 1.0 µg DNA

RPL23AP68 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Autoinducing Peptide I
T82930-01 5 mg

Autoinducing Peptide I

Sign In for Pricing
View Details
Autoinducing Peptide I
T82930-02 50 mg

Autoinducing Peptide I

Sign In for Pricing
View Details