Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Taf1c Rabbit Polyclonal Antibody (Biotin)

Taf1c Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MTAFI, Tafi95, mTAFI95

UniProt

Q6PDZ2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RRHRGETSETQTQSKRPKRRTQLSSTFSSFTSYLDSPDASSAPRSQDLST

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_067416

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (PE)
131866-PE 100 µL

Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (PE)

Sign In for Pricing
View Details
Compound Fr12686
Fr12686-01 200 mg

Compound Fr12686

Sign In for Pricing
View Details
Compound Fr12686
Fr12686-02 1 g

Compound Fr12686

Sign In for Pricing
View Details
SPAM1 (Sperm Adhesion Molecule 1, HYA1, PH20, HYAL1, HYAL3, HYAL5, PH-20, SPAG15) (MaxLight 650)
MBS6438648-01 0.1 mL

SPAM1 (Sperm Adhesion Molecule 1, HYA1, PH20, HYAL1, HYAL3, HYAL5, PH-20, SPAG15) (MaxLight 650)

Sign In for Pricing
View Details
SPAM1 (Sperm Adhesion Molecule 1, HYA1, PH20, HYAL1, HYAL3, HYAL5, PH-20, SPAG15) (MaxLight 650)
MBS6438648-02 5x 0.1 mL

SPAM1 (Sperm Adhesion Molecule 1, HYA1, PH20, HYAL1, HYAL3, HYAL5, PH-20, SPAG15) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral human CACNA2D2 shRNA (UAS) - Lentiviral human CACNA2D2 shRNA (UAS, iRFP) (25)
GTR15148934 1 Vial

Lentiviral human CACNA2D2 shRNA (UAS) - Lentiviral human CACNA2D2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details