Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lcorl Rabbit Polyclonal Antibody (HRP)

Lcorl Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ml, Mlr1

UniProt

Q3U285

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTLQKMVTQFKEKNESLQYETSNPPVQLKIPQLRVNSVSKSQADGSGLLD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_742165

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF39 (RING Finger Protein 39, Protein HZFw, HZFW) (MaxLight 650)
138298-ML650 100 µL

RNF39 (RING Finger Protein 39, Protein HZFw, HZFW) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Human NUP214 Protein, N-His
orb3149594-01 50 µg

Recombinant Human NUP214 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NUP214 Protein, N-His
orb3149594-02 100 µg

Recombinant Human NUP214 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NUP214 Protein, N-His
orb3149594-03 1 mg

Recombinant Human NUP214 Protein, N-His

Sign In for Pricing
View Details
Olfr299 shRNA (m) Lentiviral Particles
sc-150732-V 200 µL

Olfr299 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Lentiviral human IGLL5 sgRNA gene knockout kit - Lentiviral human IGLL5 sgRNA gene knockout kit (100)
GTR15389554 1 Vial

Lentiviral human IGLL5 sgRNA gene knockout kit - Lentiviral human IGLL5 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details