Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ehf Rabbit Polyclonal Antibody (FITC)

Ehf Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AU019492, 9030625L19Rik

UniProt

Q9NZC4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Ehf

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_031940

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMM50 Rabbit mAb Antibody
orb1726679-01 50 µL

SAMM50 Rabbit mAb Antibody

Sign In for Pricing
View Details
SAMM50 Rabbit mAb Antibody
orb1726679-02 100 µL

SAMM50 Rabbit mAb Antibody

Sign In for Pricing
View Details
CD367 Antibody (PE)
orb1881238 100 Tests

CD367 Antibody (PE)

Sign In for Pricing
View Details
Dnmt1 Rabbit Polyclonal Antibody (Fluoro550)
orb3119701 100 µg

Dnmt1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Epha1, ID (Epha1, Esk, Ephrin type-A receptor 1, Embryonic stem cell kinase, Tyrosine-protein kinase receptor ESK) (MaxLight 550)
MBS6295959-01 0.1 mL

Epha1, ID (Epha1, Esk, Ephrin type-A receptor 1, Embryonic stem cell kinase, Tyrosine-protein kinase receptor ESK) (MaxLight 550)

Sign In for Pricing
View Details
Epha1, ID (Epha1, Esk, Ephrin type-A receptor 1, Embryonic stem cell kinase, Tyrosine-protein kinase receptor ESK) (MaxLight 550)
MBS6295959-02 5x 0.1 mL

Epha1, ID (Epha1, Esk, Ephrin type-A receptor 1, Embryonic stem cell kinase, Tyrosine-protein kinase receptor ESK) (MaxLight 550)

Sign In for Pricing
View Details