Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ehf Rabbit Polyclonal Antibody (HRP)

Ehf Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AU019492, 9030625L19Rik

UniProt

Q9NZC4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Ehf

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_031940

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBP3 (Retinol-binding Protein 3, Interphotoreceptor Retinoid-binding Protein, IRBP, Interstitial Retinol-binding Protein) (MaxLight 750)
MBS6234927-01 0.1 mL

RBP3 (Retinol-binding Protein 3, Interphotoreceptor Retinoid-binding Protein, IRBP, Interstitial Retinol-binding Protein) (MaxLight 750)

Sign In for Pricing
View Details
RBP3 (Retinol-binding Protein 3, Interphotoreceptor Retinoid-binding Protein, IRBP, Interstitial Retinol-binding Protein) (MaxLight 750)
MBS6234927-02 5x 0.1 mL

RBP3 (Retinol-binding Protein 3, Interphotoreceptor Retinoid-binding Protein, IRBP, Interstitial Retinol-binding Protein) (MaxLight 750)

Sign In for Pricing
View Details
Horse Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit
MBS9390639-01 48 Well

Horse Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit

Sign In for Pricing
View Details
Horse Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit
MBS9390639-02 96 Well

Horse Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit

Sign In for Pricing
View Details
Horse Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit
MBS9390639-03 5x 96 Well

Horse Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit

Sign In for Pricing
View Details
Horse Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit
MBS9390639-04 10x 96 Well

Horse Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit

Sign In for Pricing
View Details