Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Elf3 Rabbit Polyclonal Antibody (FITC)

Elf3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ES, je, ESX, jen, ESE-, ESE-1

UniProt

Q3UPW2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Elf3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIP140, ID (NRIP1, Nuclear receptor-interacting protein 1, Nuclear factor RIP140, Receptor-interacting protein 140) (MaxLight 750) discontinued
041059-ML750 100 µL

RIP140, ID (NRIP1, Nuclear receptor-interacting protein 1, Nuclear factor RIP140, Receptor-interacting protein 140) (MaxLight 750) discontinued

Sign In for Pricing
View Details
GTF3C3 Rabbit Polyclonal Antibody (HRP)
orb2132874 100 µL

GTF3C3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Chemokine Receptor FKSG80 (G-Protein Coupled Receptor 81, GPR81, G-Protein Coupled Receptor 104, GPR104, LACR1, TA-GPCR) (AP)
MBS6468676-01 0.2 mL

Chemokine Receptor FKSG80 (G-Protein Coupled Receptor 81, GPR81, G-Protein Coupled Receptor 104, GPR104, LACR1, TA-GPCR) (AP)

Sign In for Pricing
View Details
Chemokine Receptor FKSG80 (G-Protein Coupled Receptor 81, GPR81, G-Protein Coupled Receptor 104, GPR104, LACR1, TA-GPCR) (AP)
MBS6468676-02 5x 0.2 mL

Chemokine Receptor FKSG80 (G-Protein Coupled Receptor 81, GPR81, G-Protein Coupled Receptor 104, GPR104, LACR1, TA-GPCR) (AP)

Sign In for Pricing
View Details
Lentiviral mouse Aifm2 shRNA (UAS) - Lentiviral mouse Aifm2 shRNA (UAS) plasmid
GTR15299914 1 Vial

Lentiviral mouse Aifm2 shRNA (UAS) - Lentiviral mouse Aifm2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
CCDC22 Protein (N-His, Human)
P501295 100 µg

CCDC22 Protein (N-His, Human)

Sign In for Pricing
View Details