Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD2 Rabbit Polyclonal Antibody (Biotin)

MBD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DMTase, NY-CO-41

UniProt

Q9UBB5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MBD2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_056647

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cesium (Cs) 10000 ppm Single Element Std. Soln. for ICP in H2 O Nist Traceable
815652-01 100 mL

Cesium (Cs) 10000 ppm Single Element Std. Soln. for ICP in H2 O Nist Traceable

Sign In for Pricing
View Details
Cesium (Cs) 10000 ppm Single Element Std. Soln. for ICP in H2 O Nist Traceable
815652-02 500 mL

Cesium (Cs) 10000 ppm Single Element Std. Soln. for ICP in H2 O Nist Traceable

Sign In for Pricing
View Details
Rno-miR-378b miRNA Agomir
CMS0684-01 5 nmol

Rno-miR-378b miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-378b miRNA Agomir
CMS0684-02 10 nmol

Rno-miR-378b miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-378b miRNA Agomir
CMS0684-03 20 nmol

Rno-miR-378b miRNA Agomir

Sign In for Pricing
View Details
Canine Cohesin subunit SA 3 (STAG3) ELISA kit
GTR10448490 96 Well

Canine Cohesin subunit SA 3 (STAG3) ELISA kit

Sign In for Pricing
View Details