Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD2 Rabbit Polyclonal Antibody (HRP)

MBD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DMTase, NY-CO-41

UniProt

Q9UBB5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MBD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_056647

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCLK2 Protein Vector (Mouse) (pPB-N-His)
PV170783 500 ng

DCLK2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Polyclonal Antibody to Tankyrase 1 Binding Protein 1 (TNKS1BP1)
TRV-0058953-01 20 µL

Polyclonal Antibody to Tankyrase 1 Binding Protein 1 (TNKS1BP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Tankyrase 1 Binding Protein 1 (TNKS1BP1)
TRV-0058953-02 100 µL

Polyclonal Antibody to Tankyrase 1 Binding Protein 1 (TNKS1BP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Tankyrase 1 Binding Protein 1 (TNKS1BP1)
TRV-0058953-03 200 µL

Polyclonal Antibody to Tankyrase 1 Binding Protein 1 (TNKS1BP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Tankyrase 1 Binding Protein 1 (TNKS1BP1)
TRV-0058953-04 1 mL

Polyclonal Antibody to Tankyrase 1 Binding Protein 1 (TNKS1BP1)

Sign In for Pricing
View Details
Recombinant Hepatitis E virus genotype 3 Pro-secreted protein ORF2 (ORF2), partial
CSB-YP897430HHAM-01 20 µg

Recombinant Hepatitis E virus genotype 3 Pro-secreted protein ORF2 (ORF2), partial

Sign In for Pricing
View Details