Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD3 Rabbit Polyclonal Antibody (Biotin)

MBD3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

O95983

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MBD3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO4 (NM_012176) Human Tagged Lenti ORF Clone
RC208458L2 10 µg

FBXO4 (NM_012176) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FBXW11 Antibody
GWB-MP463D 50 µg

FBXW11 Antibody

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) Recombinant Rabbit Monoclonal Antibody [Clone KRT7/4387R]
MBS4382037-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) Recombinant Rabbit Monoclonal Antibody [Clone KRT7/4387R]

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) Recombinant Rabbit Monoclonal Antibody [Clone KRT7/4387R]
MBS4382037-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) Recombinant Rabbit Monoclonal Antibody [Clone KRT7/4387R]

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) Recombinant Rabbit Monoclonal Antibody [Clone KRT7/4387R]
MBS4382037-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) Recombinant Rabbit Monoclonal Antibody [Clone KRT7/4387R]

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) Recombinant Rabbit Monoclonal Antibody [Clone KRT7/4387R]
MBS4382037-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) Recombinant Rabbit Monoclonal Antibody [Clone KRT7/4387R]

Sign In for Pricing
View Details