Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD3 Rabbit Polyclonal Antibody (HRP)

MBD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O95983

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MBD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti- G Protein-Coupled Receptor OGR1/GPR68 Human Antibody
GWB-37AEE3 0.05 mg

Anti- G Protein-Coupled Receptor OGR1/GPR68 Human Antibody

Sign In for Pricing
View Details
ZNF749 Polyclonal Antibody, APC-Cy7 Conjugated
bs-20400R-APC-Cy7 100 µL

ZNF749 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
TRIM69 E3 Ubiquitin-Protein Ligase TRIM69, Tripartite Motif Containing 69)
494624 100 µL

TRIM69 E3 Ubiquitin-Protein Ligase TRIM69, Tripartite Motif Containing 69)

Sign In for Pricing
View Details
Krtap5-1 Mouse Gene Knockout Kit (CRISPR)
KN509067 1 Kit

Krtap5-1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Chd5 Pre-designed siRNA Set A
SI102510A 1 Each

Mouse Chd5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Cholecystokinin B Receptor ELISA Kit
MBS040654 Inquire

Rabbit Cholecystokinin B Receptor ELISA Kit

Sign In for Pricing
View Details