Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gapdh Rabbit Polyclonal Antibody (HRP)

Gapdh Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ga, Gapd

UniProt

P16858

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Gapdh

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032110

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (C5/473 + CD5/54/F6), CF405S conjugate, 0.1mg/mL
BNC040748-100 1x 100 µL

CD5 (C5/473 + CD5/54/F6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Olfactory receptor 13C8 (OR13C8) (NM_001004483) Human Recombinant Protein
TP323507L 1 mg

Olfactory receptor 13C8 (OR13C8) (NM_001004483) Human Recombinant Protein

Sign In for Pricing
View Details
GPRASP2 (NM_001004051) Human Over-expression Lysate
LY424050 100 µg

GPRASP2 (NM_001004051) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS633970 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
DBF4 Antibody
8C11821-AAT 50 µg

DBF4 Antibody

Sign In for Pricing
View Details
COMMD6 Human Gene Knockout Kit (CRISPR)
KN414768 1 Kit

COMMD6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details