Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prmt6 Rabbit Polyclonal Antibody (HRP)

Prmt6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hrmt1l6

UniProt

D4A307

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NEPVPVEQDTDISGEITLLPSRDNPRRLRVLLRYKVGDHEEKTKDFAMED

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001099936

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGA12 shRNA (h) Lentiviral Particles
sc-106766-V 200 µL

PCDHGA12 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
FAM71F1 Antibody, Biotin conjugated
A65438-50UG 50 µg

FAM71F1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Cell cycle exit and neuronal differentiation protein 1 (CEND1) Mouse ELISA Kit
C2664 96 Tests

Cell cycle exit and neuronal differentiation protein 1 (CEND1) Mouse ELISA Kit

Sign In for Pricing
View Details
Recombinant Oceanobacillus iheyensis Glycerol-3-phosphate acyltransferase 1 (plsY1), partial
MBS7054976 Inquire

Recombinant Oceanobacillus iheyensis Glycerol-3-phosphate acyltransferase 1 (plsY1), partial

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 3- (3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase
MBS1207434-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O17:K52:H18 3- (3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 3- (3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase
MBS1207434-02 0.02 mg (Yeast)

Recombinant Escherichia coli O17:K52:H18 3- (3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase

Sign In for Pricing
View Details