Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRMT2 Rabbit Polyclonal Antibody (HRP)

PRMT2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HRMT1L1

UniProt

P55345

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRMT2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001526

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DNA Replication Licensing Factor MCM3 ELISA Kit
MBS7256001-01 48 Well

Mouse DNA Replication Licensing Factor MCM3 ELISA Kit

Sign In for Pricing
View Details
Mouse DNA Replication Licensing Factor MCM3 ELISA Kit
MBS7256001-02 96 Well

Mouse DNA Replication Licensing Factor MCM3 ELISA Kit

Sign In for Pricing
View Details
Mouse DNA Replication Licensing Factor MCM3 ELISA Kit
MBS7256001-03 5x 96 Well

Mouse DNA Replication Licensing Factor MCM3 ELISA Kit

Sign In for Pricing
View Details
Mouse DNA Replication Licensing Factor MCM3 ELISA Kit
MBS7256001-04 10x 96 Well

Mouse DNA Replication Licensing Factor MCM3 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal PAC2 Antibody (OTI1E8) [Alexa Fluor 532]
NBP2-73215AF532 0.1 mL

Mouse Monoclonal PAC2 Antibody (OTI1E8) [Alexa Fluor 532]

Sign In for Pricing
View Details
PPP3R2 (NM_147180) Human Over-expression Lysate
LS005535 100 µg

PPP3R2 (NM_147180) Human Over-expression Lysate

Sign In for Pricing
View Details