Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT18 Rabbit Polyclonal Antibody (Biotin)

KRT18 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

K18, CK-18, CYK18

UniProt

P05783

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KRT18

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSF

Field of Research

Cancer Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000215

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

KvLQT1 (Potassium Voltage-gated Channel Subfamily KQT Member 1, KCNQ1, ATFB1, ATFB3, FLJ26167, IKs Producing Slow Voltage-gated Potassium Channel Subunit alpha KvLQT1, JLNS1, KCNA8, KCNA9, KQT-like 1, Kv1.9, Kv7.1, LQT, LQT1, RWS, SQT2, Voltage-gated Potassium Channel Subunit Kv7.1, WRS) (APC) discontinued
K9100-10B-APC 200 µL

KvLQT1 (Potassium Voltage-gated Channel Subfamily KQT Member 1, KCNQ1, ATFB1, ATFB3, FLJ26167, IKs Producing Slow Voltage-gated Potassium Channel Subunit alpha KvLQT1, JLNS1, KCNA8, KCNA9, KQT-like 1, Kv1.9, Kv7.1, LQT, LQT1, RWS, SQT2, Voltage-gated Potassium Channel Subunit Kv7.1, WRS) (APC) discontinued

Sign In for Pricing
View Details
CHI3L2 Rabbit pAb
E45R27581N-50 50 µL

CHI3L2 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Rhesus Macaque PGAP2 Protein, His (Fc)-Avi-tagged
PGAP2-3205R 50 µg

Recombinant Rhesus Macaque PGAP2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Bovine Anti-fibrillarin antibody(AFA/snoRNP/U3RNP) ELISA Kit
MBS2608788-01 48 Well

Bovine Anti-fibrillarin antibody(AFA/snoRNP/U3RNP) ELISA Kit

Sign In for Pricing
View Details
Bovine Anti-fibrillarin antibody(AFA/snoRNP/U3RNP) ELISA Kit
MBS2608788-02 96 Well

Bovine Anti-fibrillarin antibody(AFA/snoRNP/U3RNP) ELISA Kit

Sign In for Pricing
View Details
Bovine Anti-fibrillarin antibody(AFA/snoRNP/U3RNP) ELISA Kit
MBS2608788-03 5x 96 Well

Bovine Anti-fibrillarin antibody(AFA/snoRNP/U3RNP) ELISA Kit

Sign In for Pricing
View Details