Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT18 Rabbit Polyclonal Antibody (HRP)

KRT18 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K18, CK-18, CYK18

UniProt

P05783

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KRT18

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIV

Field of Research

Cancer Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_000215

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC16A Protein Vector (Mouse) (pPB-C-His)
PV227374 500 ng

SEC16A Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rat Glutathione synthetase (GSS) ELISA kit
CKbio-19594-01 48 Tests

Rat Glutathione synthetase (GSS) ELISA kit

Sign In for Pricing
View Details
Rat Glutathione synthetase (GSS) ELISA kit
CKbio-19594-02 96 Tests

Rat Glutathione synthetase (GSS) ELISA kit

Sign In for Pricing
View Details
Rat Glutathione synthetase (GSS) ELISA kit
CKbio-19594-03 5x 96 Tests

Rat Glutathione synthetase (GSS) ELISA kit

Sign In for Pricing
View Details
Rat Glutathione synthetase (GSS) ELISA kit
CKbio-19594-04 10x 96 Tests

Rat Glutathione synthetase (GSS) ELISA kit

Sign In for Pricing
View Details
Recombinant Escherichia coli O139:H28 Prolipoprotein diacylglyceryl transferase (lgt)
orb2907163-01 20 µg

Recombinant Escherichia coli O139:H28 Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details