Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL9 Rabbit Polyclonal Antibody (HRP)

RPL9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L9, NPC-A-16

UniProt

P32969

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RPL9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIY

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000652

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PQBP1 (NM_005710) Human Tagged ORF Clone
RG223943 10 µg

PQBP1 (NM_005710) Human Tagged ORF Clone

Sign In for Pricing
View Details
MAST205 (A-7) Alexa Fluor® 680
sc-377198 AF680 200 µg/mL

MAST205 (A-7) Alexa Fluor® 680

Sign In for Pricing
View Details
AKAP8 (NM_005858) Human Tagged Lenti ORF Clone
RC205349L4 10 µg

AKAP8 (NM_005858) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Actl7b Rat shRNA Plasmid (Locus ID 313183)
TL702931 1 Kit

Actl7b Rat shRNA Plasmid (Locus ID 313183)

Sign In for Pricing
View Details
SSR1 (TRAP alpha) mouse monoclonal antibody
E43B4287 100 µL

SSR1 (TRAP alpha) mouse monoclonal antibody

Sign In for Pricing
View Details
Tgfb1i1 (NM_001289553) Mouse Untagged Clone
MC227215 10 µg

Tgfb1i1 (NM_001289553) Mouse Untagged Clone

Sign In for Pricing
View Details