Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL9 Rabbit Polyclonal Antibody (FITC)

RPL9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L9, NPC-A-16

UniProt

P32969

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RPL9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000652

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Jagged 1/JAG1 Protein (His Tag)
PKSH031043-01 50 µg

Recombinant Human Jagged 1/JAG1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Jagged 1/JAG1 Protein (His Tag)
PKSH031043-02 500 µg

Recombinant Human Jagged 1/JAG1 Protein (His Tag)

Sign In for Pricing
View Details
N-Ethyl-N-(perfluoro-1-octanesulfonyl) Glycine
TRC-E925518-50MG 50 mg

N-Ethyl-N-(perfluoro-1-octanesulfonyl) Glycine

Sign In for Pricing
View Details
Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF640R conjugate, 0.1mg/mL
BNC401600-500 1x 500 µL

Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF647 conjugate, 0.1mg/mL
BNC472711-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC Anti-Human CD273/PD-L2 Antibody[24F.10C12]
E-AB-F1175E-01 20 Tests

APC Anti-Human CD273/PD-L2 Antibody[24F.10C12]

Sign In for Pricing
View Details