Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL9 Rabbit Polyclonal Antibody (HRP)

RPL9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L9, NPC-A-16

UniProt

P32969

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RPL9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000652

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (C5/473), 0.2mg/mL
BNUB0473-500 1x 500 µL

CD5 (C5/473), 0.2mg/mL

Sign In for Pricing
View Details
Cd276 Mouse Gene Knockout Kit (CRISPR)
KN502894 1 Kit

Cd276 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
eNOS (NOS3) (N-term) Rabbit Polyclonal Antibody
AP18138PU-N 400 µL

eNOS (NOS3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF594 conjugate, 0.1mg/mL
BNC942035-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit
RD-FNDC5-Ra-01 96 Tests

Rat Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details
Rat Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit
RD-FNDC5-Ra-02 48 Tests

Rat Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details