Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL8 Rabbit Polyclonal Antibody (HRP)

RPL8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L8

UniProt

P62917

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RPL8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_000964

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Bcl x (BCL2L1) activation kit by CRISPRa
GA100412 1 Kit

Human Bcl x (BCL2L1) activation kit by CRISPRa

Sign In for Pricing
View Details
ELISA Kit For Peroxisome assembly factor 2
E12069m 96 Tests

ELISA Kit For Peroxisome assembly factor 2

Sign In for Pricing
View Details
ALDH9A1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0072206 1.0 µg DNA

ALDH9A1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human NPVF Pre-designed siRNA Set A
SI010761A 1 Each

Human NPVF Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Bla g 5 (v2)
E4A10Y16-v2 50 µg

Recombinant Bla g 5 (v2)

Sign In for Pricing
View Details
Lentiviral human CD55 sgRNA gene knockout kit - Lentiviral human CD55 sgRNA gene knockout kit (100)
GTR15356626 1 Vial

Lentiviral human CD55 sgRNA gene knockout kit - Lentiviral human CD55 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details