Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpl32 Rabbit Polyclonal Antibody (HRP)

Rpl32 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RpL3, AU020185, rpL32-3A

UniProt

A2AD25

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rpl32

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_742083

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIPC3, CT (GIPC3, C19orf64, PDZ domain-containing protein GIPC3) (Azide free) (HRP) discontinued
036046-HRP 200 µL

GIPC3, CT (GIPC3, C19orf64, PDZ domain-containing protein GIPC3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Endoplasmic Reticulum Lipid Raft Associated Protein 2 (ERLIN2) Polyclonal Antibody
CAU21466-01 100 µL

Endoplasmic Reticulum Lipid Raft Associated Protein 2 (ERLIN2) Polyclonal Antibody

Sign In for Pricing
View Details
Endoplasmic Reticulum Lipid Raft Associated Protein 2 (ERLIN2) Polyclonal Antibody
CAU21466-02 200 µL

Endoplasmic Reticulum Lipid Raft Associated Protein 2 (ERLIN2) Polyclonal Antibody

Sign In for Pricing
View Details
Endoplasmic Reticulum Lipid Raft Associated Protein 2 (ERLIN2) Polyclonal Antibody
CAU21466-03 1 mL

Endoplasmic Reticulum Lipid Raft Associated Protein 2 (ERLIN2) Polyclonal Antibody

Sign In for Pricing
View Details
U2AF1L4 ORF Vector (Human) (pORF)
ORF011206 1.0 µg DNA

U2AF1L4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Research Grade Miromavimab
DVV03502 100 μg

Research Grade Miromavimab

Sign In for Pricing
View Details