Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPLP0 Rabbit Polyclonal Antibody (Biotin)

RPLP0 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P0, LP0, L10E, RPP0, PRLP0

UniProt

P05388

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPLP0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000993

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-Hesperetin 3’,7-Diglucuronide
TRC-H348990-25MG 25 mg

(S)-Hesperetin 3’,7-Diglucuronide

Sign In for Pricing
View Details
UPP2 Mouse Monoclonal Antibody [Clone ID: OTI9G9]
CF812319 100 µg

UPP2 Mouse Monoclonal Antibody [Clone ID: OTI9G9]

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS806617 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
NSFL1C Human Gene Knockout Kit (CRISPR)
KN401022 1 Kit

NSFL1C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hoechst 33342 Fluorescent Nucleic Acid Stain
639 1 mL

Hoechst 33342 Fluorescent Nucleic Acid Stain

Sign In for Pricing
View Details
Rat IgM Mu chain specific F(ab’)2 Fragment Mouse Monoclonal Antibody [Clone ID: M 2A1]
AM08096PU-N 500 µg

Rat IgM Mu chain specific F(ab’)2 Fragment Mouse Monoclonal Antibody [Clone ID: M 2A1]

Sign In for Pricing
View Details