Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPLP0 Rabbit Polyclonal Antibody (FITC)

RPLP0 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P0, LP0, L10E, RPP0, PRLP0

UniProt

P05388

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPLP0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000993

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP17A1, ID (Steroid 17-alpha-hydroxylase/17,20 Lyase, Steroid 17-alpha-Monooxygenase, Cytochrome P450-C17, Cytochrome P450c17, CYPXVII, Cytochrome P450 17A1, Cytochrome P450-C17, Cytochrome P450c17, CYP17, S17AH) (MaxLight 750) discontinued
C8929-03B-ML750 100 µL

CYP17A1, ID (Steroid 17-alpha-hydroxylase/17,20 Lyase, Steroid 17-alpha-Monooxygenase, Cytochrome P450-C17, Cytochrome P450c17, CYPXVII, Cytochrome P450 17A1, Cytochrome P450-C17, Cytochrome P450c17, CYP17, S17AH) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mouse Nrm Pre-designed siRNA Set A
SI109595A 1 Each

Mouse Nrm Pre-designed siRNA Set A

Sign In for Pricing
View Details
CD69 Protein (C-His, Human)
P502217 100 µg

CD69 Protein (C-His, Human)

Sign In for Pricing
View Details
GLYCTK Rabbit Polyclonal Antibody
orb511865 100 µg

GLYCTK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ZNF106 Pre-designed siRNA Set A
SI018627A 1 Each

Human ZNF106 Pre-designed siRNA Set A

Sign In for Pricing
View Details
NDRG3 (NM_022477) Human Tagged ORF Clone Lentiviral Particle
RC217761L3V 200 µL

NDRG3 (NM_022477) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details