Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOSC10 Rabbit Polyclonal Antibody (FITC)

EXOSC10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P2, p3, p4, RRP6, PMSCL, Rrp6p, PM-Scl, PMSCL2, PM/Scl-100

UniProt

Q01780

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human EXOSC10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001001998

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant Early Growth Response Protein 1 (EGR1) ELISA Kit
MBS9379242 Inquire

Plant Early Growth Response Protein 1 (EGR1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human DHH Protein, N-His
orb2969927-01 50 µg

Recombinant Human DHH Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DHH Protein, N-His
orb2969927-02 100 µg

Recombinant Human DHH Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DHH Protein, N-His
orb2969927-03 1 mg

Recombinant Human DHH Protein, N-His

Sign In for Pricing
View Details
Rat Chromosome transmission fidelity protein 8 homolog (CHTF8) ELISA Kit
abx509057 96 Tests

Rat Chromosome transmission fidelity protein 8 homolog (CHTF8) ELISA Kit

Sign In for Pricing
View Details
Ccdc42b siRNA Oligos set (Mouse)
15265174 3x 5 nmol

Ccdc42b siRNA Oligos set (Mouse)

Sign In for Pricing
View Details