Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBMS3 Rabbit Polyclonal Antibody (HRP)

RBMS3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6XE24

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RBMS3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001003792

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Neuropeptide Y Receptor Y2 (NPY2R) ELISA Kit
DLR-NPY2R-Ra-96T 96 Tests

Rat Neuropeptide Y Receptor Y2 (NPY2R) ELISA Kit

Sign In for Pricing
View Details
AF366264 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
11467064 1.0 µg DNA

AF366264 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (2F6), 0.2mg/mL
BNUB1014-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (2F6), 0.2mg/mL

Sign In for Pricing
View Details
Neodymium perchlorate
N03740 25 g

Neodymium perchlorate

Sign In for Pricing
View Details
Recombinant Human NRP1 protein, N-His Tag
IMP-2457 10 µg

Recombinant Human NRP1 protein, N-His Tag

Sign In for Pricing
View Details
Arsj (NM_173451) Mouse Tagged Lenti ORF Clone
MR224832L4 10 µg

Arsj (NM_173451) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details