Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBMS3 Rabbit Polyclonal Antibody (Biotin)

RBMS3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q6XE24

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RBMS3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001003792

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Herpes virus inhibitor 1
orb1980928-01 5 mg

Herpes virus inhibitor 1

Sign In for Pricing
View Details
Herpes virus inhibitor 1
orb1980928-02 50 mg

Herpes virus inhibitor 1

Sign In for Pricing
View Details
UTY, CT (UTY, Histone demethylase UTY, Ubiquitously-transcribed TPR protein on the Y chromosome, Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein) (MaxLight 650)
MBS6362111-01 0.1 mL

UTY, CT (UTY, Histone demethylase UTY, Ubiquitously-transcribed TPR protein on the Y chromosome, Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein) (MaxLight 650)

Sign In for Pricing
View Details
UTY, CT (UTY, Histone demethylase UTY, Ubiquitously-transcribed TPR protein on the Y chromosome, Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein) (MaxLight 650)
MBS6362111-02 5x 0.1 mL

UTY, CT (UTY, Histone demethylase UTY, Ubiquitously-transcribed TPR protein on the Y chromosome, Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein) (MaxLight 650)

Sign In for Pricing
View Details
Human TRAPPC13 Pre-designed siRNA Set A
SI017269A 1 Each

Human TRAPPC13 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human NDUFS3 shRNA (UAS) - Lentiviral human NDUFS3 shRNA (UAS, RFP) plasmid
GTR15112393 1 Vial

Lentiviral human NDUFS3 shRNA (UAS) - Lentiviral human NDUFS3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details