Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNU13 Rabbit Polyclonal Antibody (Biotin)

SNU13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FA1, FA-1, NHPX, 15.5K, OTK27, SSFA1, NHP2L1, SPAG12, SNRNP15-5

UniProt

P55769

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NHP2L1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001003796

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr45 Mouse Gene Knockout Kit (CRISPR)
KN319361LP 1 Kit

Wdr45 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PAX5/2060), CF594 conjugate, 0.1mg/mL
BNC942060-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (PAX5/2060), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR51L1 (N-term) Rabbit Polyclonal Antibody
AP53072PU-N 400 µL

OR51L1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (IGA/1790R), CF405S conjugate, 0.1mg/mL
BNC041790-100 1x 100 µL

CD79a (B-Cell Marker) (IGA/1790R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDAP1 Rabbit Polyclonal Antibody
TA370493 100 µL

PDAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SHP2 (PTPN11) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F2]
TA501758AM 100 µL

SHP2 (PTPN11) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F2]

Sign In for Pricing
View Details