Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B1 Rabbit Polyclonal Antibody (Biotin)

SF3B1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MDS, PRP10, Hsh155, PRPF10, SAP155, SF3b155

UniProt

O75533

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SF3B1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

143kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_036565

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAV1 Adenovirus (Rat)
43042056 1.0 mL

SAV1 Adenovirus (Rat)

Sign In for Pricing
View Details
MIRacle™ rno-miR-186-3p miRNA Agomir/Antagomir
AM4922 2 OD, 4 OD, 50 OD

MIRacle™ rno-miR-186-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Pack of 100 discs of filter sheets for prefiltration, 90 mm
FT304A0090 Pack of 100

Pack of 100 discs of filter sheets for prefiltration, 90 mm

Sign In for Pricing
View Details
Anti-AKR1C1 / AKR1C2 Rabbit Monoclonal Antibody, Carrier-free
M03056-1-carrier-free 100 µL

Anti-AKR1C1 / AKR1C2 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Mouse PLA2G2E shRNA Plasmid
abx973808-01 150 µg

Mouse PLA2G2E shRNA Plasmid

Sign In for Pricing
View Details
Mouse PLA2G2E shRNA Plasmid
abx973808-02 300 µg

Mouse PLA2G2E shRNA Plasmid

Sign In for Pricing
View Details