Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAZ2 Rabbit Polyclonal Antibody (HRP)

DAZ2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PDP1678

UniProt

Q2KHN6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DAZ2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001005785

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STARD6, CT (STARD6, StAR-related lipid transfer protein 6, START domain-containing protein 6) (MaxLight 550)
MBS6351792-01 0.1 mL

STARD6, CT (STARD6, StAR-related lipid transfer protein 6, START domain-containing protein 6) (MaxLight 550)

Sign In for Pricing
View Details
STARD6, CT (STARD6, StAR-related lipid transfer protein 6, START domain-containing protein 6) (MaxLight 550)
MBS6351792-02 5x 0.1 mL

STARD6, CT (STARD6, StAR-related lipid transfer protein 6, START domain-containing protein 6) (MaxLight 550)

Sign In for Pricing
View Details
PIK3C2A (Phosphatidylinositol 4-phosphate 3-kinase C2 Domain-containing Subunit alpha, Phosphoinositide 3-kinase-C2-alpha, DKFZp686L193, MGC142218) (MaxLight 550)
MBS6213166-01 0.1 mL

PIK3C2A (Phosphatidylinositol 4-phosphate 3-kinase C2 Domain-containing Subunit alpha, Phosphoinositide 3-kinase-C2-alpha, DKFZp686L193, MGC142218) (MaxLight 550)

Sign In for Pricing
View Details
PIK3C2A (Phosphatidylinositol 4-phosphate 3-kinase C2 Domain-containing Subunit alpha, Phosphoinositide 3-kinase-C2-alpha, DKFZp686L193, MGC142218) (MaxLight 550)
MBS6213166-02 5x 0.1 mL

PIK3C2A (Phosphatidylinositol 4-phosphate 3-kinase C2 Domain-containing Subunit alpha, Phosphoinositide 3-kinase-C2-alpha, DKFZp686L193, MGC142218) (MaxLight 550)

Sign In for Pricing
View Details
CHIP Antibody HRP Conjugated
orb1542891 100 µL

CHIP Antibody HRP Conjugated

Sign In for Pricing
View Details
Rabbit Anti S100A9 Polyclonal Antigen affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (Western Blot,IHC)
IRBAMLS100A9AAP317200UL 1 Each

Rabbit Anti S100A9 Polyclonal Antigen affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (Western Blot,IHC)

Sign In for Pricing
View Details