Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHOSPHO2 Rabbit Polyclonal Antibody (FITC)

PHOSPHO2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC111048, MGC22679

UniProt

Q8TCD6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PHOSPHO2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001008489

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR7E46P Protein Vector (Human) (pPB-C-His)
PV108682 500 ng

OR7E46P Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Shewanella halifaxensis Negative modulator of initiation of replication (seqA)
MBS1001241-01 0.02 mg (E-Coli)

Recombinant Shewanella halifaxensis Negative modulator of initiation of replication (seqA)

Sign In for Pricing
View Details
Recombinant Shewanella halifaxensis Negative modulator of initiation of replication (seqA)
MBS1001241-02 0.1 mg (E-Coli)

Recombinant Shewanella halifaxensis Negative modulator of initiation of replication (seqA)

Sign In for Pricing
View Details
Recombinant Shewanella halifaxensis Negative modulator of initiation of replication (seqA)
MBS1001241-03 0.02 mg (Yeast)

Recombinant Shewanella halifaxensis Negative modulator of initiation of replication (seqA)

Sign In for Pricing
View Details
Recombinant Shewanella halifaxensis Negative modulator of initiation of replication (seqA)
MBS1001241-04 0.1 mg (Yeast)

Recombinant Shewanella halifaxensis Negative modulator of initiation of replication (seqA)

Sign In for Pricing
View Details
Recombinant Shewanella halifaxensis Negative modulator of initiation of replication (seqA)
MBS1001241-05 0.02 mg (Baculovirus)

Recombinant Shewanella halifaxensis Negative modulator of initiation of replication (seqA)

Sign In for Pricing
View Details