Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIP1 Rabbit Polyclonal Antibody (HRP)

SIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SIP1, SIP1-delta

UniProt

O14893

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SIP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001009182

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPUSD2 Rabbit Polyclonal Antibody (FITC)
orb2124291 100 µL

RPUSD2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Mouse Monoclonal IgM Antibody (IM373) [DyLight 550]
NBP2-34650R 0.1 mL

Mouse Monoclonal IgM Antibody (IM373) [DyLight 550]

Sign In for Pricing
View Details
Olfr1136 (NM_146659) Mouse Tagged ORF Clone Lentiviral Particle
MR215544L4V 200 µL

Olfr1136 (NM_146659) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human DLK1 Protein Lysate
MBS8410563-01 0.02 mg

Human DLK1 Protein Lysate

Sign In for Pricing
View Details
Human DLK1 Protein Lysate
MBS8410563-02 5x 0.02 mg

Human DLK1 Protein Lysate

Sign In for Pricing
View Details
EGF Receptor (phospho-Tyr1148) rabbit pAb
MBS8599976-01 0.1 mL

EGF Receptor (phospho-Tyr1148) rabbit pAb

Sign In for Pricing
View Details