Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRP70 Rabbit Polyclonal Antibody (Biotin)

SNRP70 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RPU1, Snp1, U1AP, U170K, U1RNP, RNPU1Z, SNRP70, U1-70K

UniProt

P08621

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SNRP70

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003080

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Langerin/CD207 Antibody (LGRN/7430) [Alexa Fluor 488]
NBP3-20734AF488 0.1 mL

Mouse Monoclonal Langerin/CD207 Antibody (LGRN/7430) [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Shigella Flexneri rhaB Protein (aa 1-489)
VAng-Lsx08067-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Flexneri rhaB Protein (aa 1-489)

Sign In for Pricing
View Details
SQSTM1 (NM_001142299) Human Tagged ORF Clone Lentiviral Particle
RC227343L4V 200 µL

SQSTM1 (NM_001142299) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ZNF557, NT (ZNF557, Zinc finger protein 557) (FITC) discontinued
044280-FITC 200 µL

ZNF557, NT (ZNF557, Zinc finger protein 557) (FITC) discontinued

Sign In for Pricing
View Details
PLV3-CMV-BCLAF1 (human) -6xHis-CopGFP-Puro
BZ58989 1 Vial

PLV3-CMV-BCLAF1 (human) -6xHis-CopGFP-Puro

Sign In for Pricing
View Details
LDOC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1206406 1.0 µg DNA

LDOC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details