Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX19B Rabbit Polyclonal Antibody (Biotin)

DDX19B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DBP5, RNAh, DDX19

UniProt

Q9UMR2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DDX19B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009173

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR11G2 Knockout A549 cell line
GTR15403735 1 Vial

Human OR11G2 Knockout A549 cell line

Sign In for Pricing
View Details
Rat Interleukin-1 receptor antagonist protein ELISA Kit
MBS9425375-01 96 Tests

Rat Interleukin-1 receptor antagonist protein ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin-1 receptor antagonist protein ELISA Kit
MBS9425375-02 5x 96 Tests

Rat Interleukin-1 receptor antagonist protein ELISA Kit

Sign In for Pricing
View Details
NFkB, p50, Inhibitory Ligand (cell permeable) (NF-kB, Nuclear Factor kappa B p50 Subunit, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B cells 1, NFkB1, DKFZp686C01211, DNA Binding Factor KBF1, EBP-1, KBF1, MGC54151, NF-kappa-B, NF-kB, Nuclear Factor kappa B DNA Binding Subunit) discontinued
N2301-53 500 µg

NFkB, p50, Inhibitory Ligand (cell permeable) (NF-kB, Nuclear Factor kappa B p50 Subunit, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B cells 1, NFkB1, DKFZp686C01211, DNA Binding Factor KBF1, EBP-1, KBF1, MGC54151, NF-kappa-B, NF-kB, Nuclear Factor kappa B DNA Binding Subunit) discontinued

Sign In for Pricing
View Details
Rat Anti-Mouse CD117-BIOT
1885-08 0.5 mg

Rat Anti-Mouse CD117-BIOT

Sign In for Pricing
View Details
Influenza A, Non-structural Protein (NS) (MaxLight 405) discontinued
I7649-51Y-ML405 100 µL

Influenza A, Non-structural Protein (NS) (MaxLight 405) discontinued

Sign In for Pricing
View Details