Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS24 Rabbit Polyclonal Antibody (Biotin)

RPS24 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S24, DBA3, eS24

UniProt

P62847

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPS24

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001017

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBS1L Mouse Monoclonal Antibody [Clone ID: OTI1A7]
TA800552S 30 µL

HBS1L Mouse Monoclonal Antibody [Clone ID: OTI1A7]

Sign In for Pricing
View Details
Sodium Chloride Standard, 1000 ppm NaCl
40120638-1 500 mL

Sodium Chloride Standard, 1000 ppm NaCl

Sign In for Pricing
View Details
NFKBIZ Antibody
E306126 100 µg - 200 µL

NFKBIZ Antibody

Sign In for Pricing
View Details
Human Vascular Endothelial Cell Growth Factor ELISA Kit
MBS760448-01 48 Well

Human Vascular Endothelial Cell Growth Factor ELISA Kit

Sign In for Pricing
View Details
Human Vascular Endothelial Cell Growth Factor ELISA Kit
MBS760448-02 96 Well

Human Vascular Endothelial Cell Growth Factor ELISA Kit

Sign In for Pricing
View Details
Human Vascular Endothelial Cell Growth Factor ELISA Kit
MBS760448-03 5x 96 Well

Human Vascular Endothelial Cell Growth Factor ELISA Kit

Sign In for Pricing
View Details