Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS24 Rabbit Polyclonal Antibody (FITC)

RPS24 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

S24, DBA3, eS24

UniProt

P62847

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPS24

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001017

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX7 (C-term) Rabbit Polyclonal Antibody
AP53182PU-N 400 µL

PAX7 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD47 (IAP/964 + B6H12.2), Biotin conjugate, 0.1mg/mL
BNCB1029-100 1x 100 µL

CD47 (IAP/964 + B6H12.2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UL-01 25 µg

Elab Fluor® 488 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UL-02 100 µg

Elab Fluor® 488 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
Rat CRP Recombinant Rabbit monoclonal Antibody
HA725050 100 µL

Rat CRP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Serum Amyloid P / APCS (APCS/3240), CF647 conjugate, 0.1mg/mL
BNC473240-100 1x 100 µL

Serum Amyloid P / APCS (APCS/3240), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details