Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

U2AF1L4 Rabbit Polyclonal Antibody (Biotin)

U2AF1L4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

U2af26, U2AF1L3, U2AF1RS3, U2AF1-RS3, U2AF1L3V1

UniProt

Q8WU68

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human U2AF1L4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KIGVCRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: bilateral
CS804754 5x 5 µm

Tissue FFPE Sections, Ovary: bilateral

Sign In for Pricing
View Details
JAB1 (COPS5) Human Gene Knockout Kit (CRISPR)
KN400979 1 Kit

JAB1 (COPS5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ceturegel™ Matrix hESC-Qualified, LDEV-Free
40190ES10 10 mL

Ceturegel™ Matrix hESC-Qualified, LDEV-Free

Sign In for Pricing
View Details
QIL1 (C19orf70) Human Gene Knockout Kit (CRISPR)
KN402349 1 Kit

QIL1 (C19orf70) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cd46 Mouse Monoclonal Antibody [Clone ID: MM.1]
AM32958PU-N 100 µg

Cd46 Mouse Monoclonal Antibody [Clone ID: MM.1]

Sign In for Pricing
View Details
Cd63 Rat Monoclonal Antibody [Clone ID: R5G2]
AM26556AF-N 100 µL

Cd63 Rat Monoclonal Antibody [Clone ID: R5G2]

Sign In for Pricing
View Details