Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

U2AF1 Rabbit Polyclonal Antibody (Biotin)

U2AF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RN, FP793, U2AF35, U2AFBP, RNU2AF1

UniProt

Q701P4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human U2AF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQN

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001020374

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYB5B Polyclonal Antibody
A62362-020 20 µL

CYB5B Polyclonal Antibody

Sign In for Pricing
View Details
TRAF5 Recombinant Protein
OPCA01911-100UG 100 µg

TRAF5 Recombinant Protein

Sign In for Pricing
View Details
ACE2, CT (Angiotensin-converting Enzyme 2, ACE-related Carboxypeptidase, Angiotensin-converting Enzyme Homolog, ACEH, Metalloprotease MPROT15, Processed Angiotensin-converting Enzyme 2, UNQ868/PRO1885) (Azide free) (HRP) discontinued
A2295-02D5-HRP 200 µL

ACE2, CT (Angiotensin-converting Enzyme 2, ACE-related Carboxypeptidase, Angiotensin-converting Enzyme Homolog, ACEH, Metalloprotease MPROT15, Processed Angiotensin-converting Enzyme 2, UNQ868/PRO1885) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
VDAC3 Rabbit Polyclonal Antibody
orb575400 100 µL

VDAC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLC β3 Polyclonal Antibody
UB-GEN-2698 100 µL

PLC β3 Polyclonal Antibody

Sign In for Pricing
View Details
HNRNPM Antibody
orb619388 100 µL

HNRNPM Antibody

Sign In for Pricing
View Details