Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4B Rabbit Polyclonal Antibody (HRP)

EIF4B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EIF-4B, PRO1843

UniProt

P23588

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EIF4B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QTGNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001408

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chitosan (Low MW) extrapure, 10‐150m.Pas, 90% DA
046563-01 25 g

Chitosan (Low MW) extrapure, 10‐150m.Pas, 90% DA

Sign In for Pricing
View Details
Chitosan (Low MW) extrapure, 10‐150m.Pas, 90% DA
046563-02 100 g

Chitosan (Low MW) extrapure, 10‐150m.Pas, 90% DA

Sign In for Pricing
View Details
Chitosan (Low MW) extrapure, 10‐150m.Pas, 90% DA
046563-03 500 g

Chitosan (Low MW) extrapure, 10‐150m.Pas, 90% DA

Sign In for Pricing
View Details
Tissue Protein Lysate, Spleen
LS780783 150 µg

Tissue Protein Lysate, Spleen

Sign In for Pricing
View Details
MET Protein (N-GST, Human)
P526765 100 µg

MET Protein (N-GST, Human)

Sign In for Pricing
View Details
TRPV6 CRISPR Knock Out 293T Cell Line (Human)
48535141 1x 10^6 Cells / 1.0 mL

TRPV6 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details