Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRPL Rabbit Polyclonal Antibody (HRP)

HNRPL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HNRPL, hnRNP-L, P/OKcl.14

UniProt

P14866

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001524

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCA3 CRISPR/Cas9 KO Plasmid (h)
sc-402388 20 µg

ABCA3 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Rabbit Anti-Human Cytokeratin 15 Polyclonal Antibody
PA84237HU-01 50 µg

Rabbit Anti-Human Cytokeratin 15 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Cytokeratin 15 Polyclonal Antibody
PA84237HU-02 100 µg

Rabbit Anti-Human Cytokeratin 15 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Cytokeratin 15 Polyclonal Antibody
PA84237HU-03 500 µg

Rabbit Anti-Human Cytokeratin 15 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Cytokeratin 15 Polyclonal Antibody
PA84237HU-04 1 mg

Rabbit Anti-Human Cytokeratin 15 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Map4k3 Antibody (Center)
orb1935804-01 50 µL

Mouse Map4k3 Antibody (Center)

Sign In for Pricing
View Details