Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRPL Rabbit Polyclonal Antibody (HRP)

HNRPL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HNRPL, hnRNP-L, P/OKcl.14

UniProt

P14866

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001524

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aqp1 (NM_012778) Rat Tagged Lenti ORF Clone
RR203590L4 10 µg

Aqp1 (NM_012778) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cml5 Lentiviral Activation Particles (m)
sc-427275-LAC 200 µL

Cml5 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Myosin IB (MYO1B)
141545 200 µL

Myosin IB (MYO1B)

Sign In for Pricing
View Details
Bovine Hepatitis B Surface Antigen HBsAg ELISA Kit
BG-BVN11265 1 Each

Bovine Hepatitis B Surface Antigen HBsAg ELISA Kit

Sign In for Pricing
View Details
TAF6L Human shRNA Plasmid Kit (Locus ID 10629)
TL308956 1 Kit

TAF6L Human shRNA Plasmid Kit (Locus ID 10629)

Sign In for Pricing
View Details
IK CRISPR All-in-one AAV vector set (with saCas9)(Rat)
24793156 3x 1.0 µg DNA

IK CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details