Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRSF1 Rabbit Polyclonal Antibody (Biotin)

GRSF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q12849

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GRSF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_002083

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPAR3 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-25403R-BF594 100 µL

LPAR3 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Human SURF2 Knockout A549 cell line
GTR15418026 1 Vial

Human SURF2 Knockout A549 cell line

Sign In for Pricing
View Details
Zbtb17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3878507 1.0 µg DNA

Zbtb17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
GPR32 CRISPR Activation Plasmid (h)
sc-405309-ACT 20 µg

GPR32 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
RPL3P12 sgRNA CRISPR Lentivector (Human) (Target 3)
K1874104 1.0 µg DNA

RPL3P12 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lat2 Rat shRNA Lentiviral Particle (Locus ID 317676)
TL713415V 500 µL Each

Lat2 Rat shRNA Lentiviral Particle (Locus ID 317676)

Sign In for Pricing
View Details