Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRSF1 Rabbit Polyclonal Antibody (FITC)

GRSF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q12849

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GRSF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_002083

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTA4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
22747111 3x 1.0 µg

GSTA4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PDE6B Polyclonal Antibody
E55A02920 100 µg

PDE6B Polyclonal Antibody

Sign In for Pricing
View Details
H.DECOUPE100X33RL-T3-P18 Pipe Markers for Other Liquids
N002651 220 Roll (220 Marker (s) x 1 Roll)

H.DECOUPE100X33RL-T3-P18 Pipe Markers for Other Liquids

Sign In for Pricing
View Details
Rabbit Polyclonal SLC22A8 Antibody [Biotin]
NBP2-98607B 0.1 mL

Rabbit Polyclonal SLC22A8 Antibody [Biotin]

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Junctional Adhesion Molecule 1 (JAM1)
MBS2058987-01 0.1 mL

FITC-Linked Polyclonal Antibody to Junctional Adhesion Molecule 1 (JAM1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Junctional Adhesion Molecule 1 (JAM1)
MBS2058987-02 0.2 mL

FITC-Linked Polyclonal Antibody to Junctional Adhesion Molecule 1 (JAM1)

Sign In for Pricing
View Details