Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRSF1 Rabbit Polyclonal Antibody (Biotin)

GRSF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ13125

UniProt

Q12849

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GRSF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002083

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRADD Rabbit Polyclonal Antibody (Cy7)
orb1052892 100 µL

TRADD Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Recombinant Human CLOCK Protein, N-His
YHA55301 100 μg

Recombinant Human CLOCK Protein, N-His

Sign In for Pricing
View Details
Luciferase, photinus pyralis (FITC)
MBS6250029-01 0.1 mL

Luciferase, photinus pyralis (FITC)

Sign In for Pricing
View Details
Luciferase, photinus pyralis (FITC)
MBS6250029-02 5x 0.1 mL

Luciferase, photinus pyralis (FITC)

Sign In for Pricing
View Details
EIF4E2, NT (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-bind
MBS6475319-01 0.2 mL

EIF4E2, NT (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-bind

Sign In for Pricing
View Details
EIF4E2, NT (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-bind
MBS6475319-02 5x 0.2 mL

EIF4E2, NT (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-bind

Sign In for Pricing
View Details