Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG20 Rabbit Polyclonal Antibody (FITC)

ISG20 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CD25, HEM45

UniProt

Q96AZ6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ISG20

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp11b2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
17312116 3x 1.0 µg

Cyp11b2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
KRT6A discontinued
390961 200 µL

KRT6A discontinued

Sign In for Pricing
View Details
Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_823430 (POPTRDRAFT_823430), partial
MBS7068586 Inquire

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_823430 (POPTRDRAFT_823430), partial

Sign In for Pricing
View Details
Bovine Osteocalcin (OCN) ELISA kit
201-04-0006 96 Tests

Bovine Osteocalcin (OCN) ELISA kit

Sign In for Pricing
View Details
Rabbit Polyclonal CTGF/CCN2 Antibody [DyLight 550]
NB100-724R 0.1 mL

Rabbit Polyclonal CTGF/CCN2 Antibody [DyLight 550]

Sign In for Pricing
View Details
S100A2 (S100 Calcium Binding Protein A2, CAN19, MGC111539, S100L) (MaxLight 550)
MBS6219098-01 0.1 mL

S100A2 (S100 Calcium Binding Protein A2, CAN19, MGC111539, S100L) (MaxLight 550)

Sign In for Pricing
View Details