Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG20 Rabbit Polyclonal Antibody (Biotin)

ISG20 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CD25, HEM45

UniProt

Q96AZ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ISG20

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGK

Field of Research

Infectious Disease & Virology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf54 (NM_024579) Human Over-expression Lysate
LY403006 100 µg

C1orf54 (NM_024579) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ORC1 activation kit by CRISPRa
GA103332 1 Kit

Human ORC1 activation kit by CRISPRa

Sign In for Pricing
View Details
ROS1 Mouse Monoclonal Antibody [Clone ID: OTI1F3]
CF805678 100 µg

ROS1 Mouse Monoclonal Antibody [Clone ID: OTI1F3]

Sign In for Pricing
View Details
Secretogranin 3 (SCG3) (C-term) Rabbit Polyclonal Antibody
AP23363PU-N 100 µg

Secretogranin 3 (SCG3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Ndufaf2 activation kit by CRISPRa
GA210276 1 Kit

Mouse Ndufaf2 activation kit by CRISPRa

Sign In for Pricing
View Details
GUCY1A1 Rabbit Polyclonal Antibody
AP20764PU-N 100 µg

GUCY1A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details