Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG20 Rabbit Polyclonal Antibody (HRP)

ISG20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD25, HEM45

UniProt

Q96AZ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ISG20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGK

Field of Research

Infectious Disease & Virology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLL2 (Myeloid/Lymphoid or Mixed-Lineage Leukemia 2, AAD10, ALR, CAGL114, MLL4, TNRC21) (MaxLight 405) discontinued
248792-ML405 100 µL

MLL2 (Myeloid/Lymphoid or Mixed-Lineage Leukemia 2, AAD10, ALR, CAGL114, MLL4, TNRC21) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Human MTAP Protein, N-His
HC278012-01 50 µg

Recombinant Human MTAP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MTAP Protein, N-His
HC278012-02 100 µg

Recombinant Human MTAP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MTAP Protein, N-His
HC278012-03 1 mg

Recombinant Human MTAP Protein, N-His

Sign In for Pricing
View Details
TCN2 Antibody
OAAN01502-50UL 50 µL

TCN2 Antibody

Sign In for Pricing
View Details
EGF Antibody (HRP)
orb241734-01 50 µg

EGF Antibody (HRP)

Sign In for Pricing
View Details