Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Oas1g Rabbit Polyclonal Antibody (HRP)

Oas1g Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L, O, L2, Oi, Mmu-, Mmu-L, Oas1b, Oias1, Mmu-L2, Oias-1, AI449562

UniProt

Q8K469

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKGGSSGKGTTLKGRSDADLVVFLNNLTSFEDQLNRRGEFIKEIKKQLYE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035982

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Brk (PTK6) activation kit by CRISPRa
GA103912 1 Kit

Human Brk (PTK6) activation kit by CRISPRa

Sign In for Pricing
View Details
OGT Human Gene Knockout Kit (CRISPR)
KN206822RB 1 Kit

OGT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD66b Rabbit Polyclonal Antibody
HA500100 100 µL

CD66b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR562095 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
CD45 / LCA (136-4B5), Biotin conjugate, 0.1mg/mL
BNCB0173-500 1x 500 µL

CD45 / LCA (136-4B5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human 14-3-3 epsilon/YWHAE Protein (GST Tag)
PKSH032016-01 10 µg

Recombinant Human 14-3-3 epsilon/YWHAE Protein (GST Tag)

Sign In for Pricing
View Details